PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT17523
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 219aa    MW: 24012.3 Da    PI: 8.2185
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT17523genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.89e-17157202147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+WT eEd ll   v+++G g W+ Ia +++ gR++kqc++rw + 
         EMT17523 157 RGSWTVEEDTLLRAKVHEFGIGKWTNIAMYLP-GRSGKQCRERWTNQ 202
                      89******************************.***********985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.639150207IPR017930Myb domain
SMARTSM007178.5E-15156205IPR001005SANT/Myb domain
PfamPF002491.7E-15157202IPR001005SANT/Myb domain
SuperFamilySSF466891.86E-16157211IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.0E-19157204IPR009057Homeodomain-like
CDDcd001675.59E-16159201No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MGVVPFYIRR IPIDPSLTQA FLPQKSQRLL HFFLLCLPHL YRKCSCCHCS DPTSGAAPMA  60
EWSACFDWDV AASAAENHYT SSGHGGVAQY FVHNDGGAPV GVVVIPGARS RASGCISEMD  120
PTSFPGYGSS NVPMAIAAPA RGPPRARSSG QQLRQFRGSW TVEEDTLLRA KVHEFGIGKW  180
TNIAMYLPGR SGKQCRERWT NQLDLNIEVI SQDLNFLTP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLN1R0961e-165N1R096_AEGTA; Transcription factor MYB98
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2265446
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.11e-13myb domain protein 98